Loading...
Statistics
Advertisement

Laptop Repair Mumbai: Dell, HP Laptop Service – Bombay Computers ...
www.bombaycomputers.com/
Dell HP Laptop - Mac Book Pro Air

Bombaycomputers.com

Advertisement
Conversion Technology Metas Server
Bombaycomputers.com is hosted in United States / Orlando . Bombaycomputers.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 9. First javascripts: Jquery.js, Jquery-migrate.min.js, Bootstrap.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 1. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Bombaycomputers.com

Technology

Number of occurences: 9
  • CSS
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback
  • W3 Total cache

Advertisement

Javascripts

Number of occurences: 9
  • jquery.js
  • jquery-migrate.min.js
  • bootstrap.min.js
  • jquery.knob.js
  • smoothscroll.js
  • scrollReveal.js
  • zerif.js
  • parallax.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Powered by

  • PHP/5.6.20

Used plugins, modules

Number of plugins and modules: 1
  • marketplace items

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Bombaycomputers.com

SSL certificate

    • name: /C=CA/CN=belskiy.com
    • subject:
      • C: CA
      • CN: belskiy.com
    • hash: 878697fc
    • issuer:
      • C: IL
      • O: StartCom Ltd.
      • OU: StartCom Certification Authority
      • CN: StartCom Class 1 DV Server CA
    • version: 2
    • serialNumber: 141368883674763020145662370729261549207
    • validFrom: 160626045739Z
    • validTo: 170626045739Z
    • validFrom_time_t: 1466917059
    • validTo_time_t: 1498453059
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Client Authentication, TLS Web Server Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 8E:88:CB:92:6B:43:56:1F:25:3C:EC:B8:7D:C8:E3:BF:09:1E:A3:8A
      • authorityKeyIdentifier: keyid:D7:91:4E:01:C4:B0:BF:F8:C8:67:93:44:9C:E7:33:FA:AD:93:0C:AF
      • authorityInfoAccess: OCSP - URI:http://ocsp.startssl.com CA Issuers - URI:http://aia.startssl.com/certs/sca.server1.crt
      • crlDistributionPoints: Full Name: URI:http://crl.startssl.com/sca-server1.crl
      • subjectAltName: DNS:belskiy.com, DNS:info.belskiy.com
      • issuerAltName: URI:http://www.startssl.com/
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.23223.1.2.5 CPS: https://www.startssl.com/policy
      • 1.3.6.1.4.1.11129.2.4.2: òðwhö˜ød‚¾:Œî¹(LüqQ]g“ÔDÑ g¬»OOûÄU‹&/¨H0F!›‚<ûn›Œ¢HìÑõ©0°GÞA¤BÈÔ?¨L!Œ€ÿIӁ„ÌoQ¹/Xx uIFºh:1xxðšOd*¤Vu¤¹ ´X‡»¢Ìgp <5˜ù߸ãwÍÈ ÜU‹&/ÎF0D `0+Ͳ“ƼŽÊ‘ÖÜïxþõµ0âù2-G°`}5  щ;ðÅï¬ýï [ùÄ0¹)KÅ׬~ų©g“

Meta - Bombaycomputers.com

Number of occurences: 7
  • Name:
    Content:
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: robots
    Content: noodp, noydir
  • Name: description
    Content: Dell HP Laptop - Mac Book Pro Air
  • Name: keywords
    Content: Dell HP Laptop - Mac Book Pro Air, Dell, HP, Laptop, -, Mac, Book, Pro, Air, Bombay Computers, Laptop, Repair, Service, MacBook Pro, Macbook Air, Computer, Reparing, Mumbai, Dell, HP, Acer, Toshiba, Sony, Asus Laptops.
  • Name: google-site-verification
    Content: zRX9YwCudtwHBbJ9ghsfCOwlrbhdUJzjmpnSyHi7_R4
  • Name: generator
    Content: WordPress 4.4.4

Server / Hosting

  • IP: 138.128.174.194
  • Latitude: 28.59
  • Longitude: -81.19
  • Country: United States
  • City: Orlando

Rname

  • ns22.mytruehost.com
  • ns21.mytruehost.com
  • bombaycomputers.com

Target

  • mytruehost.gmail.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 07 Aug 2016 11:23:36 GMT Server: Apache X-Powered-By: PHP/5.6.20 Link: ; rel="https://api.w.org/" Vary: User-Agent,Accept-Encoding Content-Length: 41655 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive

DNS

host: bombaycomputers.com
  1. class: IN
  2. ttl: 14399
  3. type: A
  4. ip: 138.128.174.194
host: bombaycomputers.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns22.mytruehost.com
host: bombaycomputers.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns21.mytruehost.com
host: bombaycomputers.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns21.mytruehost.com
  5. rname: mytruehost.gmail.com
  6. serial: 2015111300
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: bombaycomputers.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: bombaycomputers.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ombaycomputers.com, www.bqombaycomputers.com, www.qombaycomputers.com, www.bwombaycomputers.com, www.wombaycomputers.com, www.bzombaycomputers.com, www.zombaycomputers.com, www.bxombaycomputers.com, www.xombaycomputers.com, www.bombaycomputers.com, www.ombaycomputers.com, www.bsombaycomputers.com, www.sombaycomputers.com, www.byombaycomputers.com, www.yombaycomputers.com, www.beombaycomputers.com, www.eombaycomputers.com, www.bdombaycomputers.com, www.dombaycomputers.com, www.bcombaycomputers.com, www.combaycomputers.com, www.bmbaycomputers.com, www.bobmbaycomputers.com, www.bbmbaycomputers.com, www.bohmbaycomputers.com, www.bhmbaycomputers.com, www.bogmbaycomputers.com, www.bgmbaycomputers.com, www.bojmbaycomputers.com, www.bjmbaycomputers.com, www.bommbaycomputers.com, www.bmmbaycomputers.com, www.bo mbaycomputers.com, www.b mbaycomputers.com, www.bovmbaycomputers.com, www.bvmbaycomputers.com, www.bobaycomputers.com, www.bompbaycomputers.com, www.bopbaycomputers.com, www.bomobaycomputers.com, www.boobaycomputers.com, www.bomibaycomputers.com, www.boibaycomputers.com, www.bomkbaycomputers.com, www.bokbaycomputers.com, www.bom.baycomputers.com, www.bo.baycomputers.com, www.bomubaycomputers.com, www.boubaycomputers.com, www.bomjbaycomputers.com, www.bojbaycomputers.com, www.bomnbaycomputers.com, www.bonbaycomputers.com, www.bom-baycomputers.com, www.bo-baycomputers.com, www.bomaycomputers.com, www.bombqaycomputers.com, www.bomqaycomputers.com, www.bombwaycomputers.com, www.bomwaycomputers.com, www.bombzaycomputers.com, www.bomzaycomputers.com, www.bombxaycomputers.com, www.bomxaycomputers.com, www.bombaycomputers.com, www.bomaycomputers.com, www.bombsaycomputers.com, www.bomsaycomputers.com, www.bombyaycomputers.com, www.bomyaycomputers.com, www.bombeaycomputers.com, www.bomeaycomputers.com, www.bombdaycomputers.com, www.bomdaycomputers.com, www.bombcaycomputers.com, www.bomcaycomputers.com, www.bombycomputers.com, www.bombaoycomputers.com, www.bomboycomputers.com, www.bombapycomputers.com, www.bombpycomputers.com, www.bomba9ycomputers.com, www.bomb9ycomputers.com, www.bombaycomputers.com, www.bombycomputers.com, www.bombaiycomputers.com, www.bombiycomputers.com, www.bombauycomputers.com, www.bombuycomputers.com, www.bombacomputers.com, www.bombayzcomputers.com, www.bombazcomputers.com, www.bombayacomputers.com, www.bombaacomputers.com, www.bombayscomputers.com, www.bombascomputers.com, www.bombaydcomputers.com, www.bombadcomputers.com, www.bombaycomputers.com, www.bombacomputers.com, www.bombayccomputers.com, www.bombaccomputers.com, www.bombay computers.com, www.bomba computers.com, www.bombayomputers.com, www.bombaycdomputers.com, www.bombaydomputers.com, www.bombaycromputers.com, www.bombayromputers.com, www.bombayctomputers.com, www.bombaytomputers.com, www.bombaycvomputers.com, www.bombayvomputers.com, www.bombaycfomputers.com, www.bombayfomputers.com, www.bombaycgomputers.com, www.bombaygomputers.com, www.bombaychomputers.com, www.bombayhomputers.com, www.bombaycnomputers.com, www.bombaynomputers.com, www.bombaycmomputers.com, www.bombaymomputers.com, www.bombaycjomputers.com, www.bombayjomputers.com, www.bombaycmputers.com, www.bombaycobmputers.com, www.bombaycbmputers.com, www.bombaycohmputers.com, www.bombaychmputers.com, www.bombaycogmputers.com, www.bombaycgmputers.com, www.bombaycojmputers.com, www.bombaycjmputers.com, www.bombaycommputers.com, www.bombaycmmputers.com, www.bombayco mputers.com, www.bombayc mputers.com, www.bombaycovmputers.com, www.bombaycvmputers.com, www.bombaycoputers.com, www.bombaycompputers.com, www.bombaycopputers.com, www.bombaycomoputers.com, www.bombaycooputers.com, www.bombaycomiputers.com, www.bombaycoiputers.com, www.bombaycomkputers.com, www.bombaycokputers.com, www.bombaycom.puters.com, www.bombayco.puters.com, www.bombaycomuputers.com, www.bombaycouputers.com, www.bombaycomjputers.com, www.bombaycojputers.com, www.bombaycomnputers.com, www.bombayconputers.com, www.bombaycom-puters.com, www.bombayco-puters.com, www.bombaycomuters.com, www.bombaycompiuters.com, www.bombaycomiuters.com, www.bombaycompkuters.com, www.bombaycomkuters.com, www.bombaycompuuters.com, www.bombaycomuuters.com, www.bombaycompjuters.com, www.bombaycomjuters.com, www.bombaycompluters.com, www.bombaycomluters.com,

Other websites we recently analyzed

  1. Tax Forms
    Columbus (United States) - 50.6.15.187
    Server software: Apache
    Technology: Google Adsense, Html
    Number of Javascript: 1
    Number of meta tags: 1
  2. 기업건설정보
    디스크립션
    Korea, Republic of - 112.175.85.143
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php
    Number of Javascript: 6
    Number of meta tags: 3
  3. ifashion
    ifashion
    Lithuania - 79.98.25.28
    G Analytics ID: UA-53267986-1
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Colorbox, jQuery Cookie, jQuery UI, Php, Google Analytics
    Number of Javascript: 11
    Number of meta tags: 4
  4. Home - ATER Viterbo
    Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
    Arezzo (Italy) - 62.149.142.90
    Server software: Apache
    Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Joomla
    Number of Javascript: 7
    Number of meta tags: 4
  5. tuckerbicycle
    Check out this GoDaddy hosted webpage! http://tuckerbicycle.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  6. Lehigh Cottage
    Scottsdale (United States) - 97.74.141.128
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 4
    Number of meta tags: 4
  7. MK MEDIA - Интернет-маркетинг
    MK MEDIA - Интернет-маркетинг
    Russian Federation - 77.222.56.94
    Server software: nginx/1.9.12
    Technology: CSS, Html, Html5, Javascript, LiveInternet counter
    Number of Javascript: 1
    Number of meta tags: 4
  8. Welcome to COLORADOSPRINGSCRIMINALDEFENSELAWYER.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2
  9. Home
    Brea (United States) - 69.163.144.16
    Server software: Apache
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 2
  10. Trakehner France - Association Française du Trakehner
    Trakehner France - Site officiel de AFT - Association Française du Trakehner - Histoire - Chevaux - Elevages - Trakehner Frankreich
    United States - 159.100.190.4
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 7
    Number of meta tags: 10

Check Other Websites